PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G09260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 565aa    MW: 61570.8 Da    PI: 6.2306
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G09260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.3e-30244300259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dg+nWrKYGqK+vk+se++rsYYrCt ++C +kkkve++  d++vvei+Y+g+Hnhe
  OGLUM08G09260.1 244 GDGFNWRKYGQKQVKSSENSRSYYRCTNSNCLAKKKVEHCP-DGRVVEIIYRGTHNHE 300
                      6****************************************.***************8 PP

2WRKY100.41.1e-31411468259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vkg+++prsYYrCt+ gCpv+k+ve++ +d + +++tYeg+Hnh+
  OGLUM08G09260.1 411 SDGYRWRKYGQKIVKGNPNPRSYYRCTHDGCPVRKHVEKAPDDDNNIVVTYEGKHNHD 468
                      7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-26236302IPR003657WRKY domain
SuperFamilySSF1182907.72E-24238302IPR003657WRKY domain
PROSITE profilePS5081121.746238302IPR003657WRKY domain
SMARTSM007749.4E-33243301IPR003657WRKY domain
PfamPF031061.0E-22245300IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.6E-31404470IPR003657WRKY domain
PROSITE profilePS5081132.799405470IPR003657WRKY domain
SuperFamilySSF1182901.7E-27405470IPR003657WRKY domain
SMARTSM007742.0E-36410469IPR003657WRKY domain
PfamPF031064.3E-26412468IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MPDGYPVAPP GMERPAPEAA AAAAEPPGAK AEEEEEGPKD VGVKGTGKEE TEKVEAEKEM  60
EGKGKGKESM EVEEEGKEKE AKGKESMEVE EGKEKEGKGK AKEKEKETKV KVKEEGGEEK  120
DKGKVEVVEA KRRPAGVGAE TPILAVPMVA VPCFLASPAF AGHFSMSHQA ALASVTAQAQ  180
IQLQSPTTPY SEGLPSPFPI TPKAVMPLQR SPSGTEGSVR RSVLEKSASF QSRPHNHVSV  240
NMVGDGFNWR KYGQKQVKSS ENSRSYYRCT NSNCLAKKKV EHCPDGRVVE IIYRGTHNHE  300
PPQKTRFVKE RVAHITASSG DDETLQLVNN EIIESPSPGC KLEPGAVSEA SEQQLFCSSD  360
CEGDAGNKSE DDHPSTEPQP KRRIIETSTP LTPVLRTVRE QKIIVQAGKT SDGYRWRKYG  420
QKIVKGNPNP RSYYRCTHDG CPVRKHVEKA PDDDNNIVVT YEGKHNHDQP FRNNSESKDG  480
PVPMIIPAET TSEQPSTMTS TSEQKQPISL LKDGGDEPMK GKTSEIGGEK AVESAQTLIS  540
IKTNPDDMKN TLLKDTSAVV PVQNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-254124701977Probable WRKY transcription factor 4
2lex_A2e-254124701977Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2981860.0DQ298186.1 Oryza sativa (japonica cultivar-group) WRKY transcription factor 82 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650463.10.0PREDICTED: probable WRKY transcription factor 32 isoform X2
TrEMBLA0A0E0AT580.0A0A0E0AT58_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g17400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.13e-65WRKY DNA-binding protein 4